| IED ID | IndEnz0018001655 |
| Enzyme Type ID | peroxidase001655 |
| Protein Name |
Peroxiredoxin EC 1.11.1.24 Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin |
| Gene Name | CT1747 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Taxonomic Lineage | cellular organisms Bacteria FCB group Bacteroidetes/Chlorobi group Chlorobi Chlorobia Chlorobiales Chlorobiaceae Chlorobaculum Chlorobaculum tepidum Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Enzyme Sequence | MPLLGDDFPELKVQTTHGPMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQQRVEAFEKIGCKLIGMSVDQVFSHIKWVEWIKENLDVDITFPIVAANDRIANKLGMLHPGKGTNTVRAVFVGDPNGKVRLVLYYPQEIGRNMDEILRAVKVLQISDSNKVAMPADWPNNLLIKDHVIIPPANNVEDAKKRKEQQYDCYDWWFCHKPLDK |
| Enzyme Length | 211 |
| Uniprot Accession Number | Q8KBN8 |
| Absorption | |
| Active Site | ACT_SITE 44; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000255|HAMAP-Rule:MF_00401 |
| Activity Regulation | |
| Binding Site | BINDING 119; /note=Substrate; /evidence=ECO:0000255|HAMAP-Rule:MF_00401 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000255|HAMAP-Rule:MF_00401}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000255|HAMAP-Rule:MF_00401}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Binding site (1); Chain (1); Disulfide bond (3); Domain (1) |
| Keywords | Antioxidant;Cytoplasm;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00401}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,047 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |