| IED ID | IndEnz0018001601 |
| Enzyme Type ID | peroxidase001601 |
| Protein Name |
Peroxiredoxin TSA1-A EC 1.11.1.24 Thiol-specific antioxidant protein Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin TSA1-A |
| Gene Name | TSA1 TSA1A CAALFM_C306180CA CaO19.7417 |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida albicans (Yeast) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Enzyme Sequence | MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK |
| Enzyme Length | 196 |
| Uniprot Accession Number | Q9Y7F0 |
| Absorption | |
| Active Site | ACT_SITE 48; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P34760 |
| Activity Regulation | |
| Binding Site | BINDING 124; /note=Substrate; /evidence=ECO:0000250|UniProtKB:P34760 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P34760}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Also involved in the correct composition of the hyphal cell wall. {ECO:0000269|PubMed:16102003}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Binding site (1); Chain (1); Disulfide bond (2); Domain (1); Region (2) |
| Keywords | Antioxidant;Cytoplasm;Disulfide bond;Nucleus;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Induced by oxidative stress. {ECO:0000269|PubMed:16102003}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell surface {ECO:0000269|PubMed:12782322, ECO:0000269|PubMed:16102003}. Nucleus {ECO:0000269|PubMed:12782322, ECO:0000269|PubMed:16134099}. Cytoplasm {ECO:0000269|PubMed:12782322, ECO:0000269|PubMed:16134099}. Note=Localizes to the cell surface in hyphally grown cells, whereas no surface but mainly nuclear localization is found in yeast-form cells. {ECO:0000269|PubMed:12782322, ECO:0000269|PubMed:16102003}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,860 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |