| IED ID | IndEnz0018001570 |
| Enzyme Type ID | peroxidase001570 |
| Protein Name |
Zinc finger protein ZAT12 Protein RESPONSIVE TO HIGH LIGHT 41 |
| Gene Name | ZAT12 RHL41 At5g59820 MMN10.11 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVAISEIKSTVDVTAANCLMLLSRVGQENVDGGDQKRVFTCKTCLKQFHSFQALGGHRASHKKPNNDALSSGLMKKVKTSSHPCPICGVEFPMGQALGGHMRRHRNESGAAGGALVTRALLPEPTVTTLKKSSSGKRVACLDLSLGMVDNLNLKLELGRTVY |
| Enzyme Length | 162 |
| Uniprot Accession Number | Q42410 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transcriptional repressor involved in light acclimation, cold and oxidative stress responses. May regulate a collection of transcripts involved in response to high-light, cold and oxidative stress. {ECO:0000269|PubMed:11069694, ECO:0000269|PubMed:14722088, ECO:0000269|PubMed:15634197, ECO:0000269|PubMed:16183833}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Sequence conflict (1); Zinc finger (2) |
| Keywords | Metal-binding;Nucleus;Reference proteome;Repeat;Repressor;Transcription;Transcription regulation;Zinc;Zinc-finger |
| Interact With | |
| Induction | INDUCTION: By H(2)O(2), cold, drought, cold or heat stresses, wounding, cucumber mosaic virus (CMV), exposure to high-intensity light and low-oxygen conditions in roots. {ECO:0000269|PubMed:12368499, ECO:0000269|PubMed:14722088, ECO:0000269|PubMed:15634197, ECO:0000269|PubMed:16183833, ECO:0000269|PubMed:18201973, ECO:0000269|PubMed:18922600}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11118137; 15728337; 15923325; 16365758; 17722694; 18266923; 18650403; 18775970; 19270186; 21039566; 21419340; 22350156; 22710144; 23185443; 23382734; 23567274; 23940555; 24377444; 24962049; 25293694; 25352272; 25533953; 26556796; 26923089; 27016889; 27247031; 28044345; 28587993; 28717360; 30002259; 30067446; 30356219; 31086987; 31466344; 31519798; 31806676; 32796124; 32825569; 33250782; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,332 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |