| IED ID | IndEnz0018001498 |
| Enzyme Type ID | peroxidase001498 |
| Protein Name |
Dye-decolorizing peroxidase YfeX EC 1.11.1.- |
| Gene Name | yfeX ECs3302 ECpv15279_3233 |
| Organism | Escherichia coli O157:H7 |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
| Enzyme Sequence | MSQVQSGILPEHCRAAIWIEANVKGEVDALRAASKTFADKLATFEAKFPDAHLGAVVAFGNNIWRALSGGVGAEELKDFPGYGKGLAPTTQFDVLIHILSLRHDVNFSVAQAAMEAFGDCIEVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVHDQEMMIGRTKEANEEIDGDERPETSHLTRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLDKLMAL |
| Enzyme Length | 299 |
| Uniprot Accession Number | Q8XBI9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Has both general peroxidase activity and dye-decolorizing activity. Can catalyze the oxidation of 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) (ABTS), and the phenolic compounds guaiacol and catechol. Also decolorizes the anthraquinone dye reactive blue 19 (RB19). {ECO:0000269|PubMed:28109884}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (13); Chain (1); Helix (12); Metal binding (1); Mutagenesis (5); Turn (5) |
| Keywords | 3D-structure;Cytoplasm;Heme;Iron;Metal-binding;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P76536}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5GT2; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,096 |
| Kinetics | |
| Metal Binding | METAL 215; /note=Iron (heme proximal ligand); via tele nitrogen; /evidence=ECO:0000269|PubMed:28109884 |
| Rhea ID | |
| Cross Reference Brenda |