| IED ID | IndEnz0018001495 |
| Enzyme Type ID | peroxidase001495 |
| Protein Name |
Thioredoxin domain-containing protein 17 14 kDa thioredoxin-related protein TRP14 Protein 42-9-9 Thioredoxin-like protein 5 |
| Gene Name | Txndc17 Txnl5 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MATFEEVSVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSED |
| Enzyme Length | 123 |
| Uniprot Accession Number | Q9CQM5 |
| Absorption | |
| Active Site | ACT_SITE 43; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9BRA2; ACT_SITE 46; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9BRA2 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (5); Chain (1); Disulfide bond (1); Domain (1); Helix (6); Initiator methionine (1); Modified residue (1); Sequence conflict (4); Site (2) |
| Keywords | 3D-structure;Acetylation;Cytoplasm;Disulfide bond;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | MOD_RES 2; /note=N-acetylalanine; /evidence=ECO:0000250|UniProtKB:Q9BRA2 |
| Post Translational Modification | PTM: The oxidized protein is reduced by TRXR1. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1V9W; |
| Mapped Pubmed ID | 10725249; 11217851; 12466851; 14607844; 17007870; 21267068; 21677750; 25002534; 31911946; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,015 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |