| IED ID | IndEnz0018000542 |
| Enzyme Type ID | peroxidase000542 |
| Protein Name |
Glutathione peroxidase 1, mitochondrial CrGPx1 EC 1.11.1.9 |
| Gene Name | GPX PHGPX1 CHLREDRAFT_206090 |
| Organism | Chlamydomonas reinhardtii (Chlamydomonas smithii) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Chlorophyta core chlorophytes Chlorophyceae CS clade Chlamydomonadales Chlamydomonadaceae Chlamydomonas Chlamydomonas reinhardtii (Chlamydomonas smithii) |
| Enzyme Sequence | MLLTRKNVAVRPARAARRDVRAMSLLGNLFGGGSKPTSSTSNFHQLSALDIDKKNVDFKSLNNRVVLVVNVASKUGLTAANYKEFATLLGKYPATDLTIVAFPCNQFGGQEPGTNAEIKAFASARGFSGAGALLMDKVDVNGANASPVYNFLKVAAGDTSDIGWNFGKFLVRPDGTVFGRYAPTTGPLSLEKYIVELINSR |
| Enzyme Length | 201 |
| Uniprot Accession Number | P83564 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; Evidence={ECO:0000269|PubMed:11973339}; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: May constitute a glutathione peroxidase-like protective system against oxidative stresses. Hydrogen peroxide, tert-butyl hydroperoxide and cumene, but not phosphatidylcholine hydroperoxide, can act as acceptors. {ECO:0000269|PubMed:11973339}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-standard residue (1); Transit peptide (1) |
| Keywords | Mitochondrion;Oxidoreductase;Peroxidase;Selenium;Selenocysteine;Transit peptide |
| Interact With | |
| Induction | INDUCTION: By selenium, particularly under autotrophic conditions. {ECO:0000269|PubMed:11973339}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,499 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |