| IED ID | IndEnz0018000442 |
| Enzyme Type ID | peroxidase000442 |
| Protein Name |
Methylamine utilization protein MauG EC 1.-.-.- |
| Gene Name | mauG MexAM1_META1p2776 |
| Organism | Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (Methylobacterium extorquens) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Hyphomicrobiales Methylobacteriaceae Methylorubrum Methylorubrum extorquens (Methylobacterium dichloromethanicum) (Methylobacterium extorquens) Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (Methylobacterium extorquens) |
| Enzyme Sequence | MRAILPIPVLIAWAMVVCGGAYAVTTCSGAATATADASQQDLAALKARFRRPESVPHPKANPLTPEKVALGKALFFDPRLSRSGSVSCATCHNPSLGWSDGLTRAVGFGMVPLPRRTPPVLNLAWGTAFQWDGRADSLEAQARMPITAPDEMNMSMDLVVERLKAVPGYAPLFRNAFGSEEPIGARHVTAALATFQRTLVSGEAPFDRWALGDESAIGADAKRGFALFTGKAGCAACHSTWRFTDDSFHDIGLKAGNDLGRGKFAPPSVTAMRYAFKTPSLRDLRMEGPYMHDGQLGSLEAVLDHYIKGGEKRPSLSFEMKPFEMSERERRDLVAFLETLKAEPAAITLPQLP |
| Enzyme Length | 353 |
| Uniprot Accession Number | Q49128 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 88; /note=Heme c 1; covalent; /evidence=ECO:0000255|PROSITE-ProRule:PRU00433; BINDING 91; /note=Heme c 1; covalent; /evidence=ECO:0000255|PROSITE-ProRule:PRU00433; BINDING 234; /note=Heme c 2; covalent; /evidence=ECO:0000255|PROSITE-ProRule:PRU00433; BINDING 237; /note=Heme c 2; covalent; /evidence=ECO:0000255|PROSITE-ProRule:PRU00433 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.-.-.- |
| Enzyme Function | FUNCTION: Involved in methylamine metabolism. Essential for the maturation of the beta subunit of MADH, presumably via a step in the biosynthesis of tryptophan tryptophylquinone (TTQ), the cofactor of MADH. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: One-carbon metabolism; methylamine degradation. |
| nucleotide Binding | |
| Features | Binding site (4); Chain (1); Metal binding (3); Signal peptide (1) |
| Keywords | Electron transport;Heme;Iron;Metal-binding;Oxidoreductase;Periplasm;Reference proteome;Signal;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm. |
| Modified Residue | |
| Post Translational Modification | PTM: Binds 2 heme c groups covalently per subunit. {ECO:0000305}. |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,146 |
| Kinetics | |
| Metal Binding | METAL 92; /note=Iron (heme c 1 axial ligand); /evidence=ECO:0000255|PROSITE-ProRule:PRU00433; METAL 238; /note=Iron (heme c 2 axial ligand); /evidence=ECO:0000255|PROSITE-ProRule:PRU00433; METAL 292; /note=Iron (heme c 1 axial ligand); /evidence=ECO:0000255|PROSITE-ProRule:PRU00433 |
| Rhea ID | |
| Cross Reference Brenda |