| IED ID | IndEnz0018000409 |
| Enzyme Type ID | peroxidase000409 |
| Protein Name |
Glutathione S-transferase EC 2.5.1.18 Fragment |
| Gene Name | |
| Organism | Lactiplantibacillus plantarum (Lactobacillus plantarum) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactiplantibacillus Lactiplantibacillus plantarum (Lactobacillus plantarum) |
| Enzyme Sequence | YLFVMTNRMKLLNYSFEGLPNLKKLDEIMRQHPAVKRVLEQEGAPHTLTD |
| Enzyme Length | 50 |
| Uniprot Accession Number | C0HLL7 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by Fe(2+) and DTT. Slightly inhibited by SDS and Zn(2+). Activity is slightly increased by Mn(2+). {ECO:0000269|PubMed:32181246}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:32181246}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Glutathione S-transferase, which conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. {ECO:0000269|PubMed:32181246}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius. {ECO:0000269|PubMed:32181246}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6. {ECO:0000269|PubMed:32181246}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,887 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |