| IED ID | IndEnz0018000314 |
| Enzyme Type ID | peroxidase000314 |
| Protein Name |
Putative peroxiredoxin in rubredoxin operon EC 1.11.1.- ORF C |
| Gene Name | |
| Organism | Clostridium pasteurianum |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Clostridia Eubacteriales Clostridiaceae Clostridium Clostridium pasteurianum |
| Enzyme Sequence | MERLVGKPAPEFEMKAVKGDGRGFTEVKLGDYKGKWLVMFFYPLDFTFVCPTEITGFSKRAEEFRDLKAELLAVSCDSQYSHETWINQDIKQGGLGKINFPIASDKTTEVSTKYGIQIEEEGISLRGLFIIDPEGIVRYSVVHDLNVGRSVDETLRVLKAFQTGGMCALDWHEGDDNL |
| Enzyme Length | 178 |
| Uniprot Accession Number | P23161 |
| Absorption | |
| Active Site | ACT_SITE 50; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P0A251 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[protein]-dithiol + a hydroperoxide = [protein]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:10008, Rhea:RHEA-COMP:10593, Rhea:RHEA-COMP:10594, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:P0A251}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) |
| Keywords | Cytoplasm;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P0AE08}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,036 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:10008 |
| Cross Reference Brenda |