| IED ID | IndEnz0018000108 |
| Enzyme Type ID | peroxidase000108 |
| Protein Name |
Transcription factor UPBEAT1 Basic helix-loop-helix protein 151 AtbHLH151 bHLH 151 Transcription factor EN 146 Transcription factor bHLH151 bHLH transcription factor bHLH151 |
| Gene Name | UPB1 BHLH151 EN146 At2g47270 T8I13.11 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGVTLEGQRKESIWVLMRRQRARRALVKKIMIRPRKSVEASRRPCRAIHRRVKTLKELVPNTKTSEGLDGLFRQTADYILALEMKVKVMQTMVQVLTETNCV |
| Enzyme Length | 102 |
| Uniprot Accession Number | O22901 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transcription factor that modulates the balance between cellular proliferation and differentiation in root growth. Does not act through cytokinin and auxin signaling, but by repressing peroxidase expression in the elongation zone. {ECO:0000269|PubMed:21074051}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous initiation (1); Sequence conflict (2) |
| Keywords | DNA-binding;Differentiation;Nucleus;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Up-regulated by reactive oxygen species. {ECO:0000269|PubMed:21074051}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00981, ECO:0000269|PubMed:21074051}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11118137; 12679534; 12837951; 15272873; 16212609; 16805732; 18305208; 20219281; 22020626; 25385697; 25624148; 28992128; 30055520; 30356219; 31445703; 32609718; 33042167; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,879 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |