| IED ID | IndEnz0016000094 |
| Enzyme Type ID | tyrosinase000094 |
| Protein Name |
Hemocyanin subunit 2 Fragment |
| Gene Name | |
| Organism | Homarus americanus (American lobster) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea (true lobsters and crayfishes) Nephropoidea Nephropidae (clawed lobsters) Homarus Homarus americanus (American lobster) |
| Enzyme Sequence | GADVAHKQQSVNHLLYLVTSHYPSLDYSLL |
| Enzyme Length | 30 |
| Uniprot Accession Number | P82297 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hemocyanins are copper-containing oxygen carriers occurring freely dissolved in the hemolymph of many mollusks and arthropods. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Copper;Direct protein sequencing;Oxygen transport;Secreted;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,370 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |