| IED ID | IndEnz0010001101 |
| Enzyme Type ID | esterase001101 |
| Protein Name |
Acyl-protein thioesterase 1 EC 3.1.2.- Palmitoyl-protein hydrolase EC 3.1.2.22 |
| Gene Name | FGRAMPH1_01T20223 FGRRES_06404_M FGSG_06404 |
| Organism | Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium sambucinum species complex Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum) |
| Enzyme Sequence | MSSGRIAPLVFPAASQHTATVIFVHGLGDTGHGWASAVENWRRRQKMDEVKFILPHAPQIPISVNMGMRMPGWFDIKQLGGDVDSLIRNEDTEGIKLSQKYFHNLIQQEIDSGIVPERIVLGGFSQGGAMSLLAGLTCTSKLGGILGLSSWLLLSKTFADMVKPTDANRQTPVMMFHGEEDPIVPCERGKLSAELLKGLGYDVAWKTYPGMGHSAVPEELDEVEAFLRKQLPPKN |
| Enzyme Length | 235 |
| Uniprot Accession Number | Q4I8Q4 |
| Absorption | |
| Active Site | ACT_SITE 125; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 181; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 213; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]; Xref=Rhea:RHEA:19233, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29950, ChEBI:CHEBI:74151; EC=3.1.2.22; Evidence={ECO:0000250|UniProtKB:Q12354}; |
| DNA Binding | |
| EC Number | 3.1.2.-; 3.1.2.22 |
| Enzyme Function | FUNCTION: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo. {ECO:0000250|UniProtKB:Q12354}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Erroneous initiation (1) |
| Keywords | Cytoplasm;Fatty acid metabolism;Hydrolase;Lipid metabolism;Nucleus;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q12354}. Nucleus {ECO:0000250|UniProtKB:Q12354}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,765 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19233 |
| Cross Reference Brenda |