| IED ID | IndEnz0005001095 |
| Enzyme Type ID | lipase001095 |
| Protein Name |
Beta-2-glycoprotein 1 Apolipoprotein H Apo-H Beta-2-glycoprotein I B2GPI Beta 2 GPI |
| Gene Name | APOH |
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Carnivora Caniformia Canidae (dog coyote wolf fox) Canis Canis lupus (Gray wolf) Canis lupus familiaris (Dog) (Canis familiaris) |
| Enzyme Sequence | MISLGLILFSSVLCHVATAGRTCPKPDDIPFATVVPLKTFYDPGEQIAYTCQPGYVFRGLTRRFTCPLTGVWPTNTVRCIPRVCPFAGILENGAVRYTTFEYPNTISFACNTGFYLNGSSSAKCTEEGKWSVDLPVCTRVTCPPPSVPKFATLSVFKPLATNNSLYGNKAVFECLPHYAMFGNDTITCTAHGNWTTLPECREVKCPFPSRPDNGFVNYPAKQILYYKDKAMYGCHDTYTLDGPEVVECNKFGNWSAQPSCKASCKLSVKKATVLYQGERVKLQEKFKDGMLHGQKVSFYCKNKEKKCSYTEDAECIDGTIEIPKCFKEHSSLAFWKTDASDVKPC |
| Enzyme Length | 345 |
| Uniprot Accession Number | P33703 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (11); Domain (4); Glycosylation (6); Region (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Heparin-binding;Reference proteome;Repeat;Secreted;Signal;Sushi |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,403 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |