| IED ID | IndEnz0002019150 |
| Enzyme Type ID | protease019150 |
| Protein Name |
Complement factor B EC 3.4.21.47 C3/C5 convertase Properdin factor B Fragment |
| Gene Name | CFB BF |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | AIRCPRPHDFENGEYWPRAPYYNLSDEISFHCYDGYTLRGSANRTCQVTGRWDGQTAICDDGAGYCPNPGIPIGTRKVGTQYRLEDSVTYYCTRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTETIEGVDAEDG |
| Enzyme Length | 151 |
| Uniprot Accession Number | Q03710 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of Arg-|-Ser bond in complement component C3 alpha-chain to yield C3a and C3b, and Arg-|-Xaa bond in complement component C5 alpha-chain to yield C5a and C5b.; EC=3.4.21.47; |
| DNA Binding | |
| EC Number | 3.4.21.47 |
| Enzyme Function | FUNCTION: Factor B which is part of the alternate pathway of the complement system is cleaved by factor D into 2 fragments: Ba and Bb. Bb, a serine protease, then combines with complement factor 3b to generate the C3 or C5 convertase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Domain (2); Glycosylation (2); Non-terminal residue (2) |
| Keywords | Complement alternate pathway;Disulfide bond;Glycoprotein;Hydrolase;Immunity;Innate immunity;Protease;Reference proteome;Repeat;Secreted;Serine protease;Sushi |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,765 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |