| IED ID | IndEnz0002019103 |
| Enzyme Type ID | protease019103 |
| Protein Name |
Probable cytosol aminopeptidase EC 3.4.11.1 Leucine aminopeptidase LAP EC 3.4.11.10 Leucyl aminopeptidase |
| Gene Name | pepA GOX0293 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Rhodospirillales Acetobacteraceae Gluconobacter Gluconobacter oxydans (Gluconobacter suboxydans) Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Enzyme Sequence | MLSVIFDSFPAFSADAPRAVVLLCDAASGETFAALDKASAGAVSRAVALKGFKGEAGQSVVLPAPAEGLSQVVLAGVKPKGGAAVDAVAIENAAGRAVRLLEGVESAVLALSEGLEQFAPDAALGARLASYDFDVYRTKKSESRPVLKTLHVAVSDVAAAQTRWAALDAVSQGVILTRNLVSEPPNVLYPQTFTQRIEELRELGLTVEVLDEKAMTELGFGALLGVAQGSVHKPRTVIVRHNGGGSEAPLAFIGKGVTFDSGGISIKPAAGMDEMKTDMGGAATVIGLMSALARRKALVNAIGVVGLVENMVSGGAQRPGDIVRAYDGQTIEVLNTDAEGRLVLADVLSYTRKRFSPKLMVNLATLTGAIVVSLGYENAGLFSNSDALAKGLSEAGAQVGEGLWRMPMGEAYNRELNSDIADMKNIGGRPGSAILAAEFLKRFVGDTDWAHLDIAGTAWKTKASAIAPKGATGFGVRLLDCFVKAHEASA |
| Enzyme Length | 490 |
| Uniprot Accession Number | Q5FU70 |
| Absorption | |
| Active Site | ACT_SITE 267; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; ACT_SITE 341; /evidence=ECO:0000255|HAMAP-Rule:MF_00181 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of an N-terminal amino acid, Xaa-|-Yaa-, in which Xaa is preferably Leu, but may be other amino acids including Pro although not Arg or Lys, and Yaa may be Pro. Amino acid amides and methyl esters are also readily hydrolyzed, but rates on arylamides are exceedingly low.; EC=3.4.11.1; Evidence={ECO:0000255|HAMAP-Rule:MF_00181}; CATALYTIC ACTIVITY: Reaction=Release of an N-terminal amino acid, preferentially leucine, but not glutamic or aspartic acids.; EC=3.4.11.10; Evidence={ECO:0000255|HAMAP-Rule:MF_00181}; |
| DNA Binding | |
| EC Number | 3.4.11.1; 3.4.11.10 |
| Enzyme Function | FUNCTION: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. {ECO:0000255|HAMAP-Rule:MF_00181}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Metal binding (7) |
| Keywords | Aminopeptidase;Cytoplasm;Hydrolase;Manganese;Metal-binding;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00181}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 50,802 |
| Kinetics | |
| Metal Binding | METAL 255; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 260; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 260; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 278; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 337; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 339; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_00181; METAL 339; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_00181 |
| Rhea ID | |
| Cross Reference Brenda |