| IED ID | IndEnz0002018882 |
| Enzyme Type ID | protease018882 |
| Protein Name |
COP9 signalosome complex subunit 6 Signalosome subunit 6 |
| Gene Name | csn6 DDB_G0293180 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MTDTTTTTTTDANKLVLEKSANSSGLEVDLHPLVLINISDHFTRTKVQSNYQDNCRVIGVILGVQNGRNVEICNSFEMVYATVDKQLVLDIEYLRKKYEQLFPLYDLLGWYSTGSQVSKDDILLHKQISEHNESPLYLMLDTDSPKSKDLPVIIYESELHIVNDEPTTIFVKTPYKIQTGEAERIGVNHIAKVTPSGSEGSGLTSHLFTMHNAISMLNIRVKALSDYLQAVKEKRLPYEQNILRKASSLCNQLPTIDTHDFKKSYLQEYNDVLLVTYLASITKTSASLNDTIDKYLVSNEKQSKRRFYQ |
| Enzyme Length | 309 |
| Uniprot Accession Number | Q54C92 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Cytoplasm;Cytoplasmic vesicle;Nucleus;Reference proteome;Signalosome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. Cytoplasmic vesicle, phagosome {ECO:0000269|PubMed:16781008}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 22120990; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,107 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |