| IED ID | IndEnz0002018822 |
| Enzyme Type ID | protease018822 |
| Protein Name |
Trypsin inhibitor Cocoon shell-associated trypsin inhibitor CSTI |
| Gene Name | |
| Organism | Bombyx mori (Silk moth) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Bombycoidea (hawk-moths) Bombycidae (silkworm moths) Bombycinae Bombyx Bombyx mori (Silk moth) |
| Enzyme Sequence | NPDCLLPIKTGPCKGSFPRYAYDSSEDKCVEFIYGGCQANANNFETIEECEAACL |
| Enzyme Length | 55 |
| Uniprot Accession Number | P81902 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This cocoon shell-associated protein inhibits trypsin Activity by forming a low-dissociation complex with trypsin. May play an important part in regulating proteolytic activity in the silk gland or protecting silk proteins from degradation during histolysis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Developmental protein;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,027 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |