| IED ID | IndEnz0002017118 |
| Enzyme Type ID | protease017118 |
| Protein Name |
Chymase EC 3.4.21.39 Alpha-chymase |
| Gene Name | CMA1 |
| Organism | Cavia porcellus (Guinea pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Hystricomorpha Caviidae (cavies) Cavia (guinea pigs) Cavia porcellus (Guinea pig) |
| Enzyme Sequence | MCLLSLPLLLFLQYTRAKAGEVIGGTECKPHSRPYMAYLEIVSSEGYEKDCGGFLIRRNFVLTAAHCAGRSLTVNLGVHNKKMKEDTWQRLKVIKQFLHPNYNSSVLLHDIMLLKLEKKANLTLAVGTLPLPPECNFLTSGRMCRAAGWGRTNVEEPASDTLQEVKLRLMDPQACKHFPNFNHNLQLCVGNPRKRKSVFKGDSGGPLLCAGIAQGIVSYAHRNAKPPVVFTRISHYRPWINKILKAN |
| Enzyme Length | 247 |
| Uniprot Accession Number | A7WPL7 |
| Absorption | |
| Active Site | ACT_SITE 66; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P23946; ACT_SITE 110; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P23946; ACT_SITE 203; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P23946 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Phe-|-Xaa > Tyr-|-Xaa > Trp-|-Xaa > Leu-|-Xaa.; EC=3.4.21.39; Evidence={ECO:0000250|UniProtKB:P23946}; |
| DNA Binding | |
| EC Number | 3.4.21.39 |
| Enzyme Function | FUNCTION: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. {ECO:0000250|UniProtKB:P23946}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (2); Propeptide (1); Sequence conflict (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P23946}. Cytoplasmic granule {ECO:0000250|UniProtKB:P23946}. Note=Mast cell granules. {ECO:0000250|UniProtKB:P23946}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,666 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.39; |