| IED ID | IndEnz0002016201 |
| Enzyme Type ID | protease016201 |
| Protein Name |
Hydrogenase 3 maturation protease EC 3.4.23.51 HycI protease |
| Gene Name | hycI Z4025 ECs3573 |
| Organism | Escherichia coli O157:H7 |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
| Enzyme Sequence | MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE |
| Enzyme Length | 156 |
| Uniprot Accession Number | P0AEW0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=This enzyme specifically removes a 32-amino acid peptide from the C-terminus of the precursor of the large subunit of E.coli hydrogenase 3 by cleavage at the C-terminal side of Arg-537.; EC=3.4.23.51; Evidence={ECO:0000250|UniProtKB:P0AEV9}; |
| DNA Binding | |
| EC Number | 3.4.23.51 |
| Enzyme Function | FUNCTION: Protease involved in the C-terminal processing of HycE, the large subunit of hydrogenase 3. {ECO:0000250|UniProtKB:P0AEV9}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Metal binding (3) |
| Keywords | Aspartyl protease;Hydrolase;Metal-binding;Nickel;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,057 |
| Kinetics | |
| Metal Binding | METAL 16; /note=Nickel; /evidence=ECO:0000250; METAL 62; /note=Nickel; /evidence=ECO:0000250; METAL 90; /note=Nickel; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |