| IED ID | IndEnz0002002954 |
| Enzyme Type ID | protease002954 |
| Protein Name |
ATP-dependent protease subunit HslV EC 3.4.25.2 |
| Gene Name | hslV GTNG_1066 |
| Organism | Geobacillus thermodenitrificans (strain NG80-2) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus thermodenitrificans Geobacillus thermodenitrificans (strain NG80-2) |
| Enzyme Sequence | MDGFHATTIFAIRHNGAAAMAGDGQVTFGNAVVMKHTAKKVRRLFHGKVLAGFAGSVADAFTLFEMFEGKLEQFNGNLPRAAVELAKEWRSNKVLRRLEAMLIVMDGQHLLLVSGTGEVIEPDDGMLAIGSGGHYALAAGRALKQYAGASMTAKEIAKAALEIAADICVYTNGHIIVEEL |
| Enzyme Length | 180 |
| Uniprot Accession Number | A4IM88 |
| Absorption | |
| Active Site | ACT_SITE 7; /evidence=ECO:0000255|HAMAP-Rule:MF_00248 |
| Activity Regulation | ACTIVITY REGULATION: Allosterically activated by HslU binding. {ECO:0000255|HAMAP-Rule:MF_00248}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=ATP-dependent cleavage of peptide bonds with broad specificity.; EC=3.4.25.2; Evidence={ECO:0000255|HAMAP-Rule:MF_00248}; |
| DNA Binding | |
| EC Number | 3.4.25.2 |
| Enzyme Function | FUNCTION: Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery. {ECO:0000255|HAMAP-Rule:MF_00248}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (3) |
| Keywords | Allosteric enzyme;Cytoplasm;Hydrolase;Metal-binding;Protease;Sodium;Threonine protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00248}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,199 |
| Kinetics | |
| Metal Binding | METAL 165; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248; METAL 168; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248; METAL 171; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248 |
| Rhea ID | |
| Cross Reference Brenda |