| IED ID | IndEnz0002002605 |
| Enzyme Type ID | protease002605 |
| Protein Name |
Hydrogenase 3 maturation protease EC 3.4.23.51 HycI protease |
| Gene Name | hycI b2717 JW2687 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE |
| Enzyme Length | 156 |
| Uniprot Accession Number | P0AEV9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=This enzyme specifically removes a 32-amino acid peptide from the C-terminus of the precursor of the large subunit of E.coli hydrogenase 3 by cleavage at the C-terminal side of Arg-537.; EC=3.4.23.51; Evidence={ECO:0000269|PubMed:10727938}; |
| DNA Binding | |
| EC Number | 3.4.23.51 |
| Enzyme Function | FUNCTION: Protease involved in the C-terminal processing of HycE, the large subunit of hydrogenase 3. {ECO:0000269|PubMed:10727938}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Helix (8); Initiator methionine (1); Metal binding (3); Mutagenesis (3); Turn (2) |
| Keywords | 3D-structure;Aspartyl protease;Direct protein sequencing;Hydrolase;Metal-binding;Nickel;Protease;Reference proteome |
| Interact With | P0AFG8 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (1) |
| Cross Reference PDB | 2E85; 2I8L; |
| Mapped Pubmed ID | 15690043; 16606699; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,057 |
| Kinetics | |
| Metal Binding | METAL 16; /note=Nickel; /evidence=ECO:0000250; METAL 62; /note=Nickel; /evidence=ECO:0000250; METAL 90; /note=Nickel; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.51; |