| IED ID | IndEnz0002002434 |
| Enzyme Type ID | protease002434 |
| Protein Name |
Onchocystatin OV17 Cysteine proteinase inhibitor OV7 |
| Gene Name | |
| Organism | Onchocerca volvulus |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Spiruromorpha Filarioidea Onchocercidae Onchocerca Onchocerca volvulus |
| Enzyme Sequence | MLTIKDGTLLIHLLLFSVVALVQLQGAKSARAKNPSKMESKTGENQDRPVLLGGWEDRDPKDEEILELLPSILMKVNEQSNDEYHLMPIKLLKVSSQVVAGVKYKMDVQVARSQCKKSSNEKVDLTKCKKLEGHPEKVMTLEVWEKPWENFMRVEILGTKEV |
| Enzyme Length | 162 |
| Uniprot Accession Number | P22085 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cysteine protease inhibitor which inhibits members of the peptidase C1 family (PubMed:1512269, PubMed:12704112). In the human host, inhibits CTSL/cathepsin L and CTSS/cathepsin S and to a lesser extent CTSB/cathepsin B which may cause defects in antigen processing and thereby impair antigen-driven T cell proliferation (PubMed:12704112). {ECO:0000269|PubMed:12704112, ECO:0000269|PubMed:1512269}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Motif (1); Region (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..32; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 97..101; /note=Secondary area of contact; /evidence=ECO:0000305 |
| Gene Encoded By | |
| Mass | 18,415 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |