| IED ID | IndEnz0002002419 |
| Enzyme Type ID | protease002419 |
| Protein Name |
Cystatin-11 Cystatin-E1 Cystatin-related epididymal spermatogenic protein 2 |
| Gene Name | Cst11 Cres2 CSTE1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAAGSWKATRLLLAILVALVAFSYQVKRKTFIRIEEVSALESSVKETLEYVTDEYNKKSEDLYNFRILRILKIMKQVTGHLEYHITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVYAIPWVEVFKILKKNCTDIS |
| Enzyme Length | 139 |
| Uniprot Accession Number | Q9D269 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has antibacterial activity against the Gram-negative bacteria E.coli. May play a role in sperm maturation and fertilization. {ECO:0000250|UniProtKB:Q9H112}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Up-regulated by testicular factors. However, does not seem to be directly regulated by androgens or estrogen. {ECO:0000269|PubMed:12586767, ECO:0000269|PubMed:12700194}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q9H112}. Note=Probably secreted into the epididymis lumen, where it localizes to the outer surface of sperm. Specifically localizes to the postacrosomal and tail regions of sperm. {ECO:0000250|UniProtKB:Q9H112}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 12644294; 18391548; 21267068; 22393026; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,217 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |