| IED ID | IndEnz0002002301 |
| Enzyme Type ID | protease002301 |
| Protein Name |
m-AAA protease-interacting protein 1, mitochondrial Matrix AAA peptidase-interacting protein 1 |
| Gene Name | MAIP1 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MALAVRLLPRLLLSRPLPGWAARLRTLSSAEVKRPLSGLCYLCRRRLGSGAAPFPRVSWASAALALSARGPQRPLLSPLEVASTLPTFPSCPRRTYSTEEQPQQRQKTKMIILGFSNPINWVRTRIYSFLIWAYFDQEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKETLHVLKEKVTSLPDNHKNALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSEAISGARVFQVKLGDQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLLE |
| Enzyme Length | 291 |
| Uniprot Accession Number | A3KN05 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB). {ECO:0000250|UniProtKB:Q8WWC4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transit peptide (1) |
| Keywords | Mitochondrion;Reference proteome;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion matrix {ECO:0000250|UniProtKB:Q8WWC4}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,940 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |