| IED ID | IndEnz0002002261 |
| Enzyme Type ID | protease002261 |
| Protein Name |
Leech factor Xa inhibitor Lefaxin Fragments |
| Gene Name | |
| Organism | Haementeria depressa (Leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Rhynchobdellida Glossiphoniidae Haementeria Haementeria depressa (Leech) |
| Enzyme Sequence | FDVPEPFKWVDHFFYEKLDEQHKGLFFAFFDWGKGPDYWGKDTISLSQEQVDAKFELDLEYGIFYGNGETIENPSENGDLQGIFFSWGSE |
| Enzyme Length | 90 |
| Uniprot Accession Number | P86681 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent anticoagulant inhibiting the amidolytic activity of factor Xa (F10) (Ki=4nM) and reducing its ability to activate prothrombin (F2) in the prothrombinase complex (EC(50)=40nM). {ECO:0000269|PubMed:10595640}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (4); Non-terminal residue (1) |
| Keywords | Blood coagulation;Direct protein sequencing;Hemostasis;Protease inhibitor;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,575 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |