| IED ID | IndEnz0002002008 |
| Enzyme Type ID | protease002008 |
| Protein Name |
Hirudin-2 Hirudin II |
| Gene Name | |
| Organism | Hirudo medicinalis (Medicinal leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Hirudo Hirudo medicinalis (Medicinal leech) |
| Enzyme Sequence | ITYTDCTESGQDLCLCEGSNVCGKGNKCILGSNGEENQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Enzyme Length | 65 |
| Uniprot Accession Number | P28504 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Glycosylation (1); Helix (1); Modified residue (1); Region (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 63; /note=Sulfotyrosine; /evidence=ECO:0000250 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (51) |
| Cross Reference PDB | 1A3B; 1A3E; 1ABI; 1C1U; 1C1V; 1C1W; 1C4U; 1C5L; 1C5N; 1C5O; 1D9I; 1FPC; 1GHV; 1GHW; 1GHX; 1GHY; 1GJ4; 1GJ5; 1IHS; 1NM6; 1NT1; 1NY2; 1O2G; 1QBV; 1SB1; 1SL3; 1TA2; 1TA6; 1TMT; 1TWX; 1VR1; 1XM1; 1YPE; 1YPG; 1YPJ; 1YPK; 1YPL; 1YPM; 1ZRB; 2GDE; 2HGT; 2PKS; 3VXE; 3VXF; 6ZUG; 6ZUH; 6ZUN; 6ZUU; 6ZUW; 6ZUX; 6ZV7; 6ZV8; |
| Mapped Pubmed ID | 10543954; 10713516; 10779411; 11292354; 11731301; 12598231; 12742021; 12873514; 1445905; 15051174; 15163182; 15299843; 15572256; 15801822; 16374786; 16895415; 17341023; 18019535; 1942057; 23712263; 33108181; 8251938; 8272424; 9468142; 9622548; 9703466; 9772168; |
| Motif | |
| Gene Encoded By | |
| Mass | 6,987 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |