| IED ID | IndEnz0002001997 |
| Enzyme Type ID | protease001997 |
| Protein Name |
Cystatin-C Cystatin-3 |
| Gene Name | CST3 |
| Organism | Saimiri sciureus (Common squirrel monkey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Platyrrhini (New World monkeys) Cebidae Saimiriinae Saimiri (squirrel monkeys) Saimiri sciureus (Common squirrel monkey) |
| Enzyme Sequence | MAGPLRAPLLLLAILAVALALSPAAGASPGRTPRLLGGPMDASVEEEGVRRALDFAVSEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEMGRTTCTKNQPNLDNCPFHEQPHLKRKAFCSFQIYSVPWQGIMTLSKSTCQDA |
| Enzyme Length | 146 |
| Uniprot Accession Number | O19093 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Modified residue (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Amyloid;Disulfide bond;Phosphoprotein;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | MOD_RES 43; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01034 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 81..85; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 15,946 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |