| IED ID | IndEnz0002001996 |
| Enzyme Type ID | protease001996 |
| Protein Name |
Cystatin-B RbCyt-B Stefin-B |
| Gene Name | |
| Organism | Oplegnathus fasciatus (Barred knifejaw) (Scaradon fasciatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Eupercaria Centrarchiformes (sunfishes and others) Terapontoidei Oplegnathidae (knifejaws) Oplegnathus Oplegnathus fasciatus (Barred knifejaw) (Scaradon fasciatus) |
| Enzyme Sequence | MSMMCGGISAPLDADEDIQKMCDNVKPHAEEKAGKKYDVFTAKTYTTQIVSGTNYFIKIHVGGDDHVHLRVYKKLPCHGGGLELSGMQHSKSLQDPIAYF |
| Enzyme Length | 100 |
| Uniprot Accession Number | J7FQE8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Thiol protease inhibitor. Has papain inhibitory activity in vitro. May be involved in immune responses against invading Gram-negative bacteria. {ECO:0000269|PubMed:22626887}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Motif (1); Site (1) |
| Keywords | Cytoplasm;Immunity;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By bacterial infection. E.tarda bacteria causes significant up-regulation in head kidney between 12 hours and 24 hours post-infection and in spleen between 24 hours and 48 hours post-infection. {ECO:0000269|PubMed:22626887}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P04080}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 48..52; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P04080 |
| Gene Encoded By | |
| Mass | 11,046 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |