| IED ID | IndEnz0002001951 |
| Enzyme Type ID | protease001951 |
| Protein Name |
Putative signal peptidase complex catalytic subunit SEC11B EC 3.4.21.89 SEC11 homolog B SEC11-like protein 2 |
| Gene Name | SEC11B SEC11L2 SPCS4B |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MNKWRLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVLLSGSMEPAFHRGYLLFLTNRVEDPIRVGEIAVLRIEGRKIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQDQHWLEKKDVVGRARGFVPYIGIGTSLMNDYPKHKYEVLFLLGLFVLVHRE |
| Enzyme Length | 166 |
| Uniprot Accession Number | P0C7V7 |
| Absorption | |
| Active Site | ACT_SITE 43; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.; EC=3.4.21.89; |
| DNA Binding | |
| EC Number | 3.4.21.89 |
| Enzyme Function | FUNCTION: Putative component of some signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Topological domain (2); Transmembrane (1) |
| Keywords | Hydrolase;Membrane;Protease;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,160 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |