| IED ID | IndEnz0002001927 |
| Enzyme Type ID | protease001927 |
| Protein Name |
Rhomboid-like protein 18 AtRBL18 |
| Gene Name | RBL18 At2g41160 T3K9.7 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MNGGPSGFNNAPVTKAFVIATALFTVFFGIRGGSSKLGLSYQDIFEKFRIWKLIISAFAFSSTTQLLSGLYLLYFFRVFERQIGSNKYSVFIFFSGFVSLILETILLSLTKDPTANLLTSGPYALVFASFVPFFLDIPVTKRFGVLGVHFSDKSFIYLAGVQLLLSSWKRSIFTGICGIIAGSLYRLNIFGIRKAKFPEFMASLFSRFSLPSLSSHSQPPRRTSPNLGRQAVRAYRAPMPSTTEPSEEAIATLVSMGFDQNAARQALVHARNDVNAATNILLEAHSH |
| Enzyme Length | 287 |
| Uniprot Accession Number | Q8RXQ2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis. {ECO:0000303|PubMed:16895613}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous gene model prediction (1); Transmembrane (6) |
| Keywords | Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18775970; 29313416; 30606781; |
| Motif | |
| Gene Encoded By | |
| Mass | 31,690 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |