| IED ID |
IndEnz0002001908 |
| Enzyme Type ID |
protease001908 |
| Protein Name |
Protein SspF
|
| Gene Name |
sspF BC_0049 |
| Organism |
Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus cereus group
Bacillus cereus
Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
|
| Enzyme Sequence |
MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKRAIEIAEQQLMKRNQ |
| Enzyme Length |
59 |
| Uniprot Accession Number |
P0A4F6 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: May play some important role in either sporulation or the dormant spore. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Site (1) |
| Keywords |
DNA-binding;Reference proteome;Sporulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
6,828 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|