| IED ID | IndEnz0002001777 |
| Enzyme Type ID | protease001777 |
| Protein Name |
Retinoic acid receptor responder protein 1 Phorbol ester-induced gene 1 protein PERG-1 RAR-responsive protein TIG1 Tazarotene-induced gene 1 protein |
| Gene Name | RARRES1 PEIG1 TIG1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF |
| Enzyme Length | 294 |
| Uniprot Accession Number | P49788 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle. {ECO:0000269|PubMed:21303978}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Natural variant (2); Region (1); Sequence conflict (1); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Membrane;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | P20155 |
| Induction | INDUCTION: By tazarotene and by all the retinoic acid receptors tested. |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:21303978}; Single-pass type III membrane protein {ECO:0000269|PubMed:21303978}. |
| Modified Residue | |
| Post Translational Modification | PTM: Not glycosylated. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15059893; 16128742; 16134180; 19250291; 19737656; 19806788; 19834535; 21168224; 21575264; 22126303; 22573467; 22615834; 22669512; 22942771; 24006221; 24014597; 27286452; 27989102; 28678839; 29169400; 29902837; 30557378; 32307444; 32634130; 32918681; 34556297; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,285 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |