| IED ID | IndEnz0002001762 |
| Enzyme Type ID | protease001762 |
| Protein Name |
Sortase A EC 3.4.22.- |
| Gene Name | srtA lmo0929 |
| Organism | Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) |
| Enzyme Sequence | MLKKTIAIIILIIGLLLIFSPFIKNGIVKYMSGHETIEQYKASDIKKNNEKDATFDFESVQLPSMTSVIKGAANYDKDAVVGSIAVPSVDVNLLVFKGTNTANLLAGATTMRSDQVMGKGNYPLAGHHMRDESMLFGPIMKVKKGDKIYLTDLENLYEYTVTETKTIDETEVSVIDNTKDARITLITCDKPTETTKRFVAVGELEKTEKLTKELENKYFPSK |
| Enzyme Length | 222 |
| Uniprot Accession Number | Q8Y8H5 |
| Absorption | |
| Active Site | ACT_SITE 127; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:Q2FV99; ACT_SITE 188; /note=Acyl-thioester intermediate; /evidence=ECO:0000250|UniProtKB:Q2FV99 |
| Activity Regulation | ACTIVITY REGULATION: Activity is enhanced by Zn(2+) and strongly enhanced by Ca(2+). Inhibited by chalcone, a precursor of several flavonoids, which blocks the SrtA active site. {ECO:0000269|PubMed:26826492}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Transpeptidase that anchors surface proteins to the cell wall (PubMed:11854224, PubMed:11929538, PubMed:16247833, PubMed:22837151). Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the sortase and its substrate, which is then transferred and covalently attached to the cell wall (Probable). This sortase recognizes a Leu-Pro-x-Thr-Gly (LPXTG) motif, which is cleaved by the sortase between the threonine and glycine residues (PubMed:11929538). Involved in pathogenesis (PubMed:11854224, PubMed:11929538, PubMed:15028680). May regulate the rate of synthesis and/or the stability of a subset of LPXTG proteins (PubMed:22837151). Not involved in cell wall-anchoring of Hbp2 (SvpA) or Hbp1 (PubMed:15028680, PubMed:16247833). {ECO:0000269|PubMed:11854224, ECO:0000269|PubMed:11929538, ECO:0000269|PubMed:15028680, ECO:0000269|PubMed:16247833, ECO:0000269|PubMed:22837151, ECO:0000305|PubMed:11929538}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (9); Chain (1); Helix (4); Mutagenesis (3); Site (1); Topological domain (2); Transmembrane (1); Turn (1) |
| Keywords | 3D-structure;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Thiol protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:11929538}; Single-pass type II membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5HU4; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,712 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |