| IED ID | IndEnz0002001755 |
| Enzyme Type ID | protease001755 |
| Protein Name |
Tumor necrosis factor receptor superfamily member 6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor CD antigen CD95 |
| Gene Name | Fas Apt1 Tnfrsf6 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENSISNSRNENEGQSLE |
| Enzyme Length | 324 |
| Uniprot Accession Number | Q63199 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (1); Glycosylation (3); Modified residue (1); Region (2); Repeat (3); Signal peptide (1); Topological domain (2); Transmembrane (1) |
| Keywords | Apoptosis;Calmodulin-binding;Cell membrane;Disulfide bond;Glycoprotein;Lipoprotein;Membrane;Palmitate;Phosphoprotein;Receptor;Reference proteome;Repeat;Signal;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P51867}; Single-pass type I membrane protein {ECO:0000250|UniProtKB:P51867}. Membrane raft {ECO:0000250|UniProtKB:P25445}. |
| Modified Residue | MOD_RES 214; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P25445 |
| Post Translational Modification | PTM: Palmitoylated. Palmitoylation by ZDHHC7 prevents the lysosomal degradation of FAS regulating its expression at the plasma membrane. {ECO:0000250|UniProtKB:P25445}. |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10024361; 10029626; 10084951; 10386469; 10632538; 10678925; 10715265; 11331665; 11332701; 11435933; 12031707; 12111799; 12522536; 12683940; 12861046; 14530904; 14679192; 14699504; 15038834; 15039424; 15254243; 15309723; 15487762; 15519734; 15528299; 15557468; 15777748; 15796164; 16000635; 16078565; 16099864; 16152783; 16154149; 16222447; 16226958; 16337971; 16392621; 16461545; 16493077; 16582846; 16609999; 16616089; 16687611; 16761189; 16796407; 16831245; 16870148; 16936193; 16953119; 16987298; 17045251; 17105443; 17195944; 17235585; 17441510; 17518537; 17703359; 17899301; 17900647; 17923548; 17953211; 17959308; 17991709; 18045865; 18204739; 18246871; 18289516; 18407603; 18410517; 18427836; 18561025; 18692025; 18981705; 19001025; 19039600; 19107989; 19151726; 19239001; 19267062; 19399403; 19407976; 19415683; 19616844; 19642903; 19820199; 19823951; 19902128; 20428798; 20448356; 20568470; 21316771; 21330946; 21384494; 21421874; 21586345; 21843499; 21868309; 22368862; 22609371; 23441449; 23934157; 23934924; 23940767; 23973665; 24307234; 24324791; 24938610; 25294749; 25310648; 25439027; 26316710; 27561622; 27606894; 27919821; 27939985; 28346613; 28501275; 28595623; 28722192; 29208459; 29213335; 29285062; 29324390; 29339218; 29522769; 29568770; 29588340; 29606031; 29634416; 29713367; 29738767; 29746994; 29844269; 29852394; 29891925; 29970988; 30122878; 30172001; 31155748; 33847039; 33994507; 8612534; 9253159; 9927315; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,835 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |